Structure of PDB 6q3q Chain B Binding Site BS01

Receptor Information
>6q3q Chain B (length=121) Species: 3701 (Arabidopsis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYYCNRAAAF
LELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTAREELVRYKEAAADFRHA
LVLEPQNKTAKVAEKRLRKHI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q3q Phosphorylation of the outer membrane mitochondrial protein OM64 influences protein import into mitochondria.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		K492 N496 Y499 T523 N527 K557 L560 R561 E586
Binding residue
(residue number reindexed from 1)		K10 N14 Y17 T41 N45 K75 L78 R79 E104
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6q3q, PDBe:6q3q, PDBj:6q3q
PDBsum6q3q
PubMed29374544
UniProtF4KCL7|OE64M_ARATH Outer envelope protein 64, mitochondrial (Gene Name=OM64)

[Back to BioLiP]