Structure of PDB 6q0u Chain B Binding Site BS01

Receptor Information
>6q0u Chain B (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMEIRVRVEKDPELGFRIAGGVGGRGNPFRPDDDGIFVTRVQPEGPASK
LLQPGDKIIQANGYSFINIEHGQAISLLKTFQNTVELIIVREV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q0u Comprehensive analysis of all evolutionary paths between two divergent PDZ domain specificities.
Resolution1.89 Å
Binding residue
(original residue number in PDB)		E13 L14 G15 F16 R17 I18 A19 G24 R25 G26 N27 P28 T39 R40 Q42 H70 I74 K78
Binding residue
(residue number reindexed from 1)		E14 L15 G16 F17 R18 I19 A20 G25 R26 G27 N28 P29 T40 R41 Q43 H71 I75 K79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6q0u, PDBe:6q0u, PDBj:6q0u
PDBsum6q0u
PubMed31654425
UniProtQ96RT1|ERBIN_HUMAN Erbin (Gene Name=ERBIN)

[Back to BioLiP]