Structure of PDB 6px6 Chain B Binding Site BS01

Receptor Information
>6px6 Chain B (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEDFVYQFKGMCYFTNGTERVRLVSRSIYNREEIVRFDSDVGEFRAVTL
LGLPAAEYWNSQKDILERKRAAVDRVCRHNYQLELRTTLQRRVEPTVTIS
PSLLVCSVTDFYPAQIKVRWFRNGQEETAGVVSTPLIRNGDWTFQILVML
EMTPQRGDVYTCHVEHPSLQSPITVEWR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6px6 A molecular basis for the T cell response in HLA-DQ2.2 mediated celiac disease.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Y9 F11 S28 Y60 W61 R70 K71 R77 H81 N82
Binding residue
(residue number reindexed from 1)		Y7 F9 S26 Y58 W59 R68 K69 R75 H79 N80
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6px6, PDBe:6px6, PDBj:6px6
PDBsum6px6
PubMed31974305
UniProtA0A0U5IHY9

[Back to BioLiP]