Structure of PDB 6pvb Chain B Binding Site BS01

Receptor Information

>6pvb Chain B (length=225) Species: 9606 (Homo sapiens)

RGSTSEVIEDEKQFYSKAKTYWKQIPPTVDGMLGGYGHISSIDINSSRKF
LQRFLREGPNKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLV
QAKTYLGEEGKRVRNYFCCGLQDFTPEPDSYDVIWIQWVIGHLTDQHLAE
FLRRCKGSLRPNGIIVIKDNMAQEGVILDDVDSSVCRDLDVVRRIICSAG
LSLLAEERQENLPDEIYHVYSFALR

Ligand information

>6pvb Chain A (length=7) Species: 32630 (synthetic construct)

aGPKRIA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6pvb Probing the Plasticity in the Active Site of Protein N-terminal Methyltransferase 1 Using Bisubstrate Analogues.
• Resolution: 1.5 Å
• Binding residue (original residue number in PDB): D28 L31 G32 G33 W136 D177 V179 D180 E213 I214 Y215
• Binding residue (residue number reindexed from 1): D30 L33 G34 G35 W138 D179 V181 D182 E215 I216 Y217

Enzymatic activity

• Enzyme Commision number: 2.1.1.244: protein N-terminal methyltransferase.

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0008168 methyltransferase activity
• GO:0008276 protein methyltransferase activity
• GO:0042054 histone methyltransferase activity
• GO:0071885 N-terminal protein N-methyltransferase activity

Biological Process

• GO:0006338 chromatin remodeling
• GO:0006480 N-terminal protein amino acid methylation
• GO:0007051 spindle organization
• GO:0007059 chromosome segregation
• GO:0018012 N-terminal peptidyl-alanine trimethylation
• GO:0018013 N-terminal peptidyl-glycine methylation
• GO:0018016 N-terminal peptidyl-proline dimethylation
• GO:0032259 methylation
• GO:0035572 N-terminal peptidyl-serine dimethylation
• GO:0035573 N-terminal peptidyl-serine trimethylation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6pvb, PDBe:6pvb, PDBj:6pvb
• PDBsum: 6pvb
• PubMed: 32605369
• UniProt: Q9BV86|NTM1A_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 1 (Gene Name=NTMT1)