Structure of PDB 6pse Chain B Binding Site BS01

Receptor Information
>6pse Chain B (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVMEAQPEWLRAEVKRLSHELAETTREKIQAAEYGLAVLEEKHQLKLQFE
ELEVDYEAIRSEMEQLKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6pse A tunable LIC1-adaptor interaction modulates dynein activity in a cargo-specific manner.
Resolution2.404 Å
Binding residue
(original residue number in PDB)		E39 Q42 A43 Y46
Binding residue
(residue number reindexed from 1)		E27 Q30 A31 Y34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008093 cytoskeletal anchor activity
GO:0070840 dynein complex binding

View graph for
Molecular Function
External links
PDB RCSB:6pse, PDBe:6pse, PDBj:6pse
PDBsum6pse
PubMed33173051
UniProtQ8TD16|BICD2_HUMAN Protein bicaudal D homolog 2 (Gene Name=BICD2)

[Back to BioLiP]