Structure of PDB 6pdw Chain B Binding Site BS01

Receptor Information

>6pdw Chain B (length=294) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EKNERTRIKAQENLRRIRRKQIDLVLNEYENQVALEVVAPEDIPVGFNDI
GGLDDIIEELKETIIYPLTMPHLYKHGGALLAAPSGVLLYGPPGCGKTML
AKAVAHESGASFINLHISTLTEKWYGDSNKIVRAVFSLAKKLQPSIIFID
EIDAVLGGEHEASGMVKAEFMTLWDGLTSTNASGVPNRIVVLGATNRIND
IDEAILRRMPKQFPVPLPGLEQRRRILELVLRGTKRDPDFDLDYIARVTA
GMSGSDIKETCRDAAMAPMREYIRQHRASGKPLSEINPDDVRGI

Ligand information

>6pdw Chain G (length=10) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAAAAAA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pdw Structure of the AAA protein Msp1 reveals mechanism of mislocalized membrane protein extraction.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	K186 W187 H227
Binding residue (residue number reindexed from 1)	K123 W124 H160

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005524	ATP binding
GO:0016887	ATP hydrolysis activity

	Biological Process
GO:0140570	extraction of mislocalized protein from mitochondrial outer membrane

	Cellular Component
GO:0005741	mitochondrial outer membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pdw, PDBe:6pdw, PDBj:6pdw
PDBsum	6pdw
PubMed	31999255
UniProt	G0S654

[Back to BioLiP]