Structure of PDB 6p8s Chain B Binding Site BS01

Receptor Information
>6p8s Chain B (length=162) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ATYSYTHSVTYVTDNILKSLKDIILLSGLDPEHFADRWESNTRAIKTWLG
TGDLRKVILEIYNPATDKLVTRWDIDIVYGWSDGDGSFWTDTEQLKYAIK
KAGLLPSQAKYKLMLDTKPGRPDVEGWSKGSYRSTDGMVKQSLGSTVEHS
GLAGQAGYWRQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p8s HORMA Domain Proteins and a Trip13-like ATPase Regulate Bacterial cGAS-like Enzymes to Mediate Bacteriophage Immunity.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S44 K116 M118 L119 T121 P123 R125 G130 W131 S132 K133 G134 Y136
Binding residue
(residue number reindexed from 1)		S40 K112 M114 L115 T117 P119 R121 G126 W127 S128 K129 G130 Y132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Biological Process
External links
PDB RCSB:6p8s, PDBe:6p8s, PDBj:6p8s
PDBsum6p8s
PubMed31932165
UniProtP0DTF6|CAP7_PSEAI CD-NTase-associated protein 7 (Gene Name=cap7)

[Back to BioLiP]