Structure of PDB 6p7q Chain B Binding Site BS01

Receptor Information
>6p7q Chain B (length=240) Species: 749537 (Escherichia coli MS 115-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDWSLSQLFASLHEDIQLRLGTARKAFQHPGAKGDASEGVWIEMLDTYLP
KRYQAANAFVVDSLGNFSDQINVVVFDRQYSPFIFKFNEQIIVPAESVYA
VFEAKQSASADLVAYAQRKVASVRRLHRTSLPIPHAGGTYPAKPLIPILG
GLLTFESDWSPALGMSFDKALNGDLSDGRLDMGCVASHGHFYFNNIDSKF
NFEHGNKPATAFLFRLIAQLQFSGTVPMIDIDAYGKWLAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p7q Structure and Mechanism of a Cyclic Trinucleotide-Activated Bacterial Endonuclease Mediating Bacteriophage Immunity.
Resolution1.66 Å
Binding residue
(original residue number in PDB)		Y81 I134 T226 P228 M229
Binding residue
(residue number reindexed from 1)		Y80 I133 T225 P227 M228
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6p7q, PDBe:6p7q, PDBj:6p7q
PDBsum6p7q
PubMed31932164
UniProtD7Y2H5|NUCC_ECOM1 Endodeoxyribonuclease NucC (Gene Name=nucC)

[Back to BioLiP]