Structure of PDB 6p7h Chain B Binding Site BS01

Receptor Information
>6p7h Chain B (length=214) Species: 9479 (Platyrrhini) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVMTQLSLSVTPGEPASISCRSSQSLLHSNGHTYLHWYLQKPGHSPQLLI
YEVSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCEQTLQTPLTF
GGGTRVQIKRTVAAPSVFIFPPSEDQVKSGTVSVVCLLNNFYPREASVKW
KVDGVLKTGNSQESVTEQDSKDNTYSLSSTLTLSNTDYQSHNVYACEVTH
QGLSSPVTKSFNRG
Ligand information
>6p7h Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AVGIGAVF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p7h Modular recognition of antigens provides a mechanism that improves vaccine-elicited antibody-class frequencies
Resolution1.782 Å
Binding residue
(original residue number in PDB)		H27D Y32 H34 Y36 Y49 E50 T91 L92
Binding residue
(residue number reindexed from 1)		H28 Y34 H36 Y38 Y51 E52 T93 L94
External links