Structure of PDB 6ozs Chain B Binding Site BS01

Receptor Information
>6ozs Chain B (length=244) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPPEETLSLWKGEQARLKARVVDRDTEAWQRDPSFSGLQKVGGVDVSFVK
GDSVRACASLVVLSYPELKVVYEDSRMVGLKAPYVSGFLAFREVPFLVEL
VQRLQEKEPDLMPQVVLVDGNGVLHQRGFGVACHLGVLTELPCIGVAKKL
LQVDGLENNALHKEKIVLLQAGGDTFPLIGSSGTVLGMALRSHDHSTKPL
YVSVGHRISLEVAVRLTHHCCRFRIPEPIRQADIRSREYIRRTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozs Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution2.41 Å
Binding residue
(original residue number in PDB)		H202 S203 T204 K205 F230 R231 R237 R244 R248
Binding residue
(residue number reindexed from 1)		H195 S196 T197 K198 F223 R224 R230 R237 R241
Enzymatic activity
Enzyme Commision number 3.1.26.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6ozs, PDBe:6ozs, PDBj:6ozs
PDBsum6ozs
PubMed31444105
UniProtQ8C9A2|ENDOV_MOUSE Endonuclease V (Gene Name=Endov)

[Back to BioLiP]