Structure of PDB 6ozf Chain B Binding Site BS01

Receptor Information
>6ozf Chain B (length=225) Species: 2336 (Thermotoga maritima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDYRQLHRWDLPPEEAIKVQNELRKKIKLTPYEGEPEYVAGVDLSFPGKE
EGLAVIVVLEYPSFKILEVVSERGEITFPYIPGLLAFREGPLFLKAWEKL
RTKPDVVVFNGQGLAHPRKLGIASHMGLFIEIPTIGVAKSRLYGTFKMPE
DKRCSWSYLYDGEEIIGCVIRTKEGSAPIFVSPGHLMDVESSKRLIKAFT
LPGRRIPEPTRLAHIYTQRLKKGLF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ozf Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		F46 Y80 P82 G83 L85 E89 N110 Q112 H116 G121 I122 A138 K139 S140 R141 L142 K221
Binding residue
(residue number reindexed from 1)		F46 Y80 P82 G83 L85 E89 N110 Q112 H116 G121 I122 A138 K139 S140 R141 L142 K221
Enzymatic activity
Enzyme Commision number 3.1.21.7: deoxyribonuclease V.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003727 single-stranded RNA binding
GO:0004519 endonuclease activity
GO:0016891 RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0043737 deoxyribonuclease V activity
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ozf, PDBe:6ozf, PDBj:6ozf
PDBsum6ozf
PubMed31444105
UniProtQ9X2H9|NFI_THEMA Endonuclease V (Gene Name=nfi)

[Back to BioLiP]