Structure of PDB 6ovf Chain B Binding Site BS01

Receptor Information
>6ovf Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPEKTDEYLLARFKGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMA
AAGRSQGQHKQRIWVNISLSGIKIIDEKTGVIEHEHPVNKISFIARDVTD
NRAFGYVCGGEGQHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEEEKK
KIEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ovf Crystal Structure of the Disabled-2 (Dab2) Dab Homology Domain in Complex with Peptide STA03
Resolution1.95 Å
Binding residue
(original residue number in PDB)		R64 G65 D66 V118 N119 K120 I121 S122 F123 I124 R126 G139 E141 V159 K163 F166 I169 Y170
Binding residue
(residue number reindexed from 1)		R34 G35 D36 V88 N89 K90 I91 S92 F93 I94 R96 G109 E111 V129 K133 F136 I139 Y140
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ovf, PDBe:6ovf, PDBj:6ovf
PDBsum6ovf
PubMed
UniProtP98082|DAB2_HUMAN Disabled homolog 2 (Gene Name=DAB2)

[Back to BioLiP]