Structure of PDB 6ov7 Chain B Binding Site BS01

Receptor Information
>6ov7 Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVG
DAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ov7 Computational Analysis of Energy Landscapes Reveals Dynamic Features That Contribute to Binding of Inhibitors to CFTR-Associated Ligand.
Resolution1.71 Å
Binding residue
(original residue number in PDB)
G290 L291 I293 S294 I295 T296 H301 V303 H311 Q314 H341 V345
Binding residue
(residue number reindexed from 1)
G15 L16 I18 S19 I20 T21 H26 V28 H36 Q39 H66 V70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005794 Golgi apparatus

View graph for
Cellular Component
External links
PDB RCSB:6ov7, PDBe:6ov7, PDBj:6ov7
PDBsum6ov7
PubMed31697075
UniProtQ9HD26|GOPC_HUMAN Golgi-associated PDZ and coiled-coil motif-containing protein (Gene Name=GOPC)

[Back to BioLiP]