Structure of PDB 6oi4 Chain B Binding Site BS01

Receptor Information
>6oi4 Chain B (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE
DDLIIFPDDCEFKRVPQCSGRVYVLKFKSKRLFFWMQEPKTDQDEEHCRK
VNEYLNNP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oi4 Phosphorylation of Tyr-950 in the proteasome scaffolding protein RPN2 modulates its interaction with the ubiquitin receptor RPN13.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		M31 T36 T37 V38 P40 K44 R64 C88 V93 K97 R104 W108 Q110
Binding residue
(residue number reindexed from 1)		M11 T16 T17 V18 P20 K24 R44 C68 V72 K76 R81 W85 Q87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Cellular Component
External links
PDB RCSB:6oi4, PDBe:6oi4, PDBj:6oi4
PDBsum6oi4
PubMed31064842
UniProtQ16186|ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 (Gene Name=ADRM1)

[Back to BioLiP]