Structure of PDB 6oes Chain B Binding Site BS01

Receptor Information
>6oes Chain B (length=344) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDI
KQNHLKLKPAIFSKDSCYLPPLRYPATCSYKKHQYIIHGGKTPNNELSDK
IYIMSVACKNNKKVTFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLF
GGRSYMPSTQRTTEKWNSVADCLPHVFLIDFEFGCATSYILPELQDGLSF
HVSIARNDTVYILGGHSLASNIRPANLYRIRVDLPLGTPAVNCTVLPGGI
SVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEISEMETPD
WTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6oes How mouse RAG recombinase avoids DNA transposition.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		A338 M339
Binding residue
(residue number reindexed from 1)		A332 M333
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0005515 protein binding
GO:0005546 phosphatidylinositol-4,5-bisphosphate binding
GO:0005547 phosphatidylinositol-3,4,5-trisphosphate binding
GO:0008270 zinc ion binding
GO:0035064 methylated histone binding
GO:0035091 phosphatidylinositol binding
GO:0043325 phosphatidylinositol-3,4-bisphosphate binding
GO:0046872 metal ion binding
GO:0080025 phosphatidylinositol-3,5-bisphosphate binding
Biological Process
GO:0002313 mature B cell differentiation involved in immune response
GO:0002326 B cell lineage commitment
GO:0002331 pre-B cell allelic exclusion
GO:0002358 B cell homeostatic proliferation
GO:0002360 T cell lineage commitment
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0030183 B cell differentiation
GO:0030217 T cell differentiation
GO:0033077 T cell differentiation in thymus
GO:0033085 negative regulation of T cell differentiation in thymus
GO:0033151 V(D)J recombination
GO:0035265 organ growth
GO:0042742 defense response to bacterium
GO:0046622 positive regulation of organ growth
GO:1904155 DN2 thymocyte differentiation
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6oes, PDBe:6oes, PDBj:6oes
PDBsum6oes
PubMed32015553
UniProtP21784|RAG2_MOUSE V(D)J recombination-activating protein 2 (Gene Name=Rag2)

[Back to BioLiP]