Structure of PDB 6o7h Chain B Binding Site BS01

Receptor Information
>6o7h Chain B (length=150) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VDASRLFGESPDVVGIKKMLEKGKQWEAIQPYFDNVVREAKNFLEWSPNK
RLANAVTVAAYLTSQGLILDMARTTELKVKIKDDLVKMRYLLAYTVGKAT
GQSKYSLDAFHRILDPMLEVLMGSPKKENFEKFYDFLQAVVAYHKFFGGG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o7h Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		T135 Q137
Binding residue
(residue number reindexed from 1)		T100 Q102
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o7h, PDBe:6o7h, PDBj:6o7h
PDBsum6o7h
PubMed31326272
UniProtB6YWB9

[Back to BioLiP]