Structure of PDB 6o7g Chain B Binding Site BS01

Receptor Information
>6o7g Chain B (length=60) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFD
CVSCQPYVVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o7g Selective binding of the PHD6 finger of MLL4 to histone H4K16ac links MLL4 and MOF.
ResolutionN/A
Binding residue
(original residue number in PDB)
L1504 E1516 L1519 L1520 I1521 Q1522 W1529 E1540
Binding residue
(residue number reindexed from 1)
L2 E14 L17 L18 I19 Q20 W27 E38
Enzymatic activity
Enzyme Commision number 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.
External links
PDB RCSB:6o7g, PDBe:6o7g, PDBj:6o7g
PDBsum6o7g
PubMed31127101
UniProtO14686|KMT2D_HUMAN Histone-lysine N-methyltransferase 2D (Gene Name=KMT2D)

[Back to BioLiP]