Structure of PDB 6o78 Chain B Binding Site BS01

Receptor Information
>6o78 Chain B (length=244) Species: 342948 (Thermococcus onnurineus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKFIAVKLIPKGPFRDIPRADTLFGAIGNAISAIHGQSAVEELVDAFVGG
ARISSAFPYSGDTYYLPKPLSVEPALEGILTEEERYTTAKRLRKAKYLDL
KNFELALRLRPFTIPEEIPYARVDVPRFWEEIRFREKSGVYFLYSGPREV
FDGYIAPAMRFLGDLFEVEFHEMKIDAPGSEYSVTLSNALPTKTPVLWRL
LRKRMTFIAEGSIVKNDPGGMERLELEVYVYGLTFPLGVELPEG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o78 Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K94 R97
Binding residue
(residue number reindexed from 1)		K90 R93
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o78, PDBe:6o78, PDBj:6o78
PDBsum6o78
PubMed31326272
UniProtB6YWC1|CSM4_THEON CRISPR system Cms protein Csm4 (Gene Name=csm4)

[Back to BioLiP]