Structure of PDB 6o6p Chain B Binding Site BS01

Receptor Information

>6o6p Chain B (length=187) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DERRGQLLVVASDVFVDRGYHAAGMDEIADRAGVSKPVLYQHFSSKLELY
LAVLHRHVENLVSGVHQALSTTTDNRQRLHVAVQAFFDFIEHDSQGYRLI
FENDFVTEPEVAAQVRVATESCIDAVFALISADSGLDPHRARMIAVGLVG
MSVDCARYWLDADKPISKSDAVEGTVQFAWGGLSHVP

Ligand information

>6o6p Chain C (length=23) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccgtacgtagaactcgccagta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6o6p Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
Resolution	3.851 Å
Binding residue (original residue number in PDB)	S72 P74
Binding residue (residue number reindexed from 1)	S35 P37

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005886	plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6o6p, PDBe:6o6p, PDBj:6o6p
PDBsum	6o6p
PubMed	32710080
UniProt	O05858

[Back to BioLiP]