Structure of PDB 6o6k Chain B Binding Site BS01

Receptor Information
>6o6k Chain B (length=69) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTF
KVNHNVPAFVSGKALKDAV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o6k Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.
Resolution3.601 Å
Binding residue
(original residue number in PDB)
V45 K83
Binding residue
(residue number reindexed from 1)
V45 K63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0042802 identical protein binding
Biological Process
GO:0006270 DNA replication initiation
GO:0006281 DNA repair
GO:0006351 DNA-templated transcription
GO:0006974 DNA damage response
GO:0030261 chromosome condensation
GO:0036386 bacterial nucleoid packaging
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0016020 membrane
GO:1990103 DnaA-HU complex
GO:1990178 HU-DNA complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6o6k, PDBe:6o6k, PDBj:6o6k
PDBsum6o6k
PubMed32518228
UniProtP0ACF0|DBHA_ECOLI DNA-binding protein HU-alpha (Gene Name=hupA)

[Back to BioLiP]