Structure of PDB 6o3x Chain B Binding Site BS01

Receptor Information
>6o3x Chain B (length=138) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDFQNFVATLESFKDLKSGISGSRIKKLTTYALDHIDIESKIISLIIDYS
RLCPDSHKLGSLYIIDSIGRAYLDETRKPGTCAHAINTLGEVIQELLSDA
IAKSNQDHKEKIRMLLDIWDRSGLFQKSYLNAIRSKCF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3x Identification of Three Sequence Motifs in the Transcription Termination Factor Sen1 that Mediate Direct Interactions with Nrd1.
Resolution1.994 Å
Binding residue
(original residue number in PDB)
S25 G26 S27 I29 Y67 D70 R74 I130
Binding residue
(residue number reindexed from 1)
S21 G22 S23 I25 Y63 D66 R70 I118
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6o3x, PDBe:6o3x, PDBj:6o3x
PDBsum6o3x
PubMed31104813
UniProtP53617|NRD1_YEAST Protein NRD1 (Gene Name=NRD1)

[Back to BioLiP]