Structure of PDB 6o3w Chain B Binding Site BS01

Receptor Information
>6o3w Chain B (length=140) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFQNFVATLESFKDLKSGISGSRIKKLTTYALDHIDIESKIISLIIDYSR
LCPDSHKLGSLYIIDSIGRAYLDETRSNNKPGTCAHAINTLGEVIQELLS
DAIAKSNQDHKEKIRMLLDIWDRSGLFQKSYLNAIRSKCF
Ligand information
>6o3w Chain C (length=11) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DDYKLPMEYIT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3w Identification of Three Sequence Motifs in the Transcription Termination Factor Sen1 that Mediate Direct Interactions with Nrd1.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Y67 K123
Binding residue
(residue number reindexed from 1)		Y62 K113
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6o3w, PDBe:6o3w, PDBj:6o3w
PDBsum6o3w
PubMed31104813
UniProtP53617|NRD1_YEAST Protein NRD1 (Gene Name=NRD1)

[Back to BioLiP]