Structure of PDB 6o3t Chain B Binding Site BS01

Receptor Information
>6o3t Chain B (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPYSYIALITMAIQNKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLS
LNECFVKVPGSYWTL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3t Crystal Structure of FOXC2 in Complex with DNA Target.
Resolution3.06 Å
Binding residue
(original residue number in PDB)		S76 Y77 N118 H122
Binding residue
(residue number reindexed from 1)		S4 Y5 N43 H47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o3t, PDBe:6o3t, PDBj:6o3t
PDBsum6o3t
PubMed31460188
UniProtQ99958|FOXC2_HUMAN Forkhead box protein C2 (Gene Name=FOXC2)

[Back to BioLiP]