Structure of PDB 6nuu Chain B Binding Site BS01

Receptor Information
>6nuu Chain B (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDT
DGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQ
VLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHK
KMVVDV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nuu Molecular basis for the binding and selective dephosphorylation of Na+/H+exchanger 1 by calcineurin.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		Q51 P53 M119 N123
Binding residue
(residue number reindexed from 1)		Q37 P39 M105 N109
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004723 calcium-dependent protein serine/threonine phosphatase activity
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0005516 calmodulin binding
GO:0008597 calcium-dependent protein serine/threonine phosphatase regulator activity
GO:0019902 phosphatase binding
GO:0019904 protein domain specific binding
GO:0046872 metal ion binding
Biological Process
GO:0001569 branching involved in blood vessel morphogenesis
GO:0001837 epithelial to mesenchymal transition
GO:0006606 protein import into nucleus
GO:0007507 heart development
GO:0014044 Schwann cell development
GO:0022011 myelination in peripheral nervous system
GO:0033173 calcineurin-NFAT signaling cascade
GO:0034504 protein localization to nucleus
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060487 lung epithelial cell differentiation
GO:0070886 positive regulation of calcineurin-NFAT signaling cascade
GO:0097720 calcineurin-mediated signaling
GO:0098693 regulation of synaptic vesicle cycle
GO:0099149 regulation of postsynaptic neurotransmitter receptor internalization
GO:0099170 postsynaptic modulation of chemical synaptic transmission
GO:1905665 positive regulation of calcium ion import across plasma membrane
GO:1905949 negative regulation of calcium ion import across plasma membrane
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005955 calcineurin complex
GO:0008287 protein serine/threonine phosphatase complex
GO:0042383 sarcolemma
GO:0045202 synapse
GO:0098685 Schaffer collateral - CA1 synapse
GO:0098686 hippocampal mossy fiber to CA3 synapse
GO:0098688 parallel fiber to Purkinje cell synapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nuu, PDBe:6nuu, PDBj:6nuu
PDBsum6nuu
PubMed31375679
UniProtP63098|CANB1_HUMAN Calcineurin subunit B type 1 (Gene Name=PPP3R1)

[Back to BioLiP]