Structure of PDB 6nid Chain B Binding Site BS01

Receptor Information
>6nid Chain B (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGD
EIREINGISVANQTVEQLQKMLREMRGSITFKIVPSYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nid CASK PDZ domain specificity
Resolution1.86 Å
Binding residue
(original residue number in PDB)		P500 M501 I503 T504 L505 R517 V549 E550 Q553
Binding residue
(residue number reindexed from 1)		P16 M17 I19 T20 L21 R33 V65 E66 Q69
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
External links
PDB RCSB:6nid, PDBe:6nid, PDBj:6nid
PDBsum6nid
PubMed
UniProtO14936|CSKP_HUMAN Peripheral plasma membrane protein CASK (Gene Name=CASK)

[Back to BioLiP]