Structure of PDB 6mwz Chain B Binding Site BS01

Receptor Information

>6mwz Chain B (length=155) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14)

FLELERSSGKLEWSAILQKMASDLGFSKILFGLLPKNAFIVGNYPAAWRE
HYDRAGYARVDPVVSHCTQSVLPIFWEPSIFQTRKQHEFFEEASAAGLVY
GLTMPLHGARGELGWLSLSVEAENRAEANRFMESVLPTLWMLKDYALQSG
AGLAF

Ligand information

>6mwz Chain M (length=6) Species: 208963 (Pseudomonas aeruginosa UCBPP-PA14)

AHHHHA

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6mwz An Autoinducer Analogue Reveals an Alternative Mode of Ligand Binding for the LasR Quorum-Sensing Receptor.
• Resolution: 1.657 Å
• Binding residue (original residue number in PDB): E11 Y157
• Binding residue (residue number reindexed from 1): E5 Y145

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0009372 quorum sensing
• GO:0010468 regulation of gene expression
• GO:0045893 positive regulation of DNA-templated transcription
• GO:0051544 positive regulation of elastin biosynthetic process
• GO:0060310 regulation of elastin catabolic process

Cellular Component

• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:6mwz, PDBe:6mwz, PDBj:6mwz
• PDBsum: 6mwz
• PubMed: 30763066
• UniProt: P25084|LASR_PSEAE Transcriptional activator protein LasR (Gene Name=lasR)