Structure of PDB 6mtv Chain B Binding Site BS01

Receptor Information
>6mtv Chain B (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANNLLIEPARIEEEELTLTILRTGGLGISIAGGKGSTPYKDEGIFISRVS
EEGPAARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGTAVQMRVWRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtv Structural analysis of phosphorylation-associated interactions of human MCC with Scribble PDZ domains.
Resolution2.597 Å
Binding residue
(original residue number in PDB)
I740 S741 I742 S761 H793 L800
Binding residue
(residue number reindexed from 1)
I28 S29 I30 S47 H79 L86
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6mtv, PDBe:6mtv, PDBj:6mtv
PDBsum6mtv
PubMed31317644
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]