Structure of PDB 6mtu Chain B Binding Site BS01

Receptor Information
>6mtu Chain B (length=96) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EPARIEEEELTLTILRGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPAA
RAGVRVGDKLLEVNGVALQGAEHHEAVEALRGAGTAVQMRVWRERM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mtu Structural analysis of phosphorylation-associated interactions of human MCC with Scribble PDZ domains.
Resolution2.141 Å
Binding residue
(original residue number in PDB)		L738 G739 I740 S741 I742 A743 G747 S748 T749 S761 H793 V797
Binding residue
(residue number reindexed from 1)		L18 G19 I20 S21 I22 A23 G27 S28 T29 S41 H73 V77
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6mtu, PDBe:6mtu, PDBj:6mtu
PDBsum6mtu
PubMed31317644
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]