Structure of PDB 6mrj Chain B Binding Site BS01

Receptor Information
>6mrj Chain B (length=142) Species: 85962 (Helicobacter pylori 26695) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DDSIIRFSVSLQQNLLDELDNRIIKNGYSSRSELVRDMIREKLVEDNWAE
DNPNDESKIAVLVVIYDHHQRELNQRMIDIQHASGTHVLCTTHIHMDEHN
CLETIILQGNSFEIQRLQLEIGGLRGVKFAKLTKASSFEYNE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mrj Crystal structure of H.pylori NikR in complex with DNA
Resolution2.8 Å
Binding residue
(original residue number in PDB)		I10 R12 S36 R37 S38 R42
Binding residue
(residue number reindexed from 1)		I4 R6 S30 R31 S32 R36
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0016151 nickel cation binding
GO:0042802 identical protein binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0010045 response to nickel cation
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6mrj, PDBe:6mrj, PDBj:6mrj
PDBsum6mrj
PubMed
UniProtO25896|NIKR_HELPY Putative nickel-responsive regulator (Gene Name=HP_1338)

[Back to BioLiP]