Structure of PDB 6mnl Chain B Binding Site BS01

Receptor Information
>6mnl Chain B (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KDVPDSQQHPAPEKSSKVSEQLKCCSGILKEMFAKKHAAYAWPFYKPVDV
EALGLHDYCDIIKHPMDMSTIKSKLEAREYRDAQEFGADVRLMFSNCYKY
NPPDHEVVAMARKLQDVFEMRFAKMPDE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mnl Targeting the BRD4/FOXO3a/CDK6 axis sensitizes AKT inhibition in luminal breast cancer.
ResolutionN/A
Binding residue
(original residue number in PDB)
W374 V380 L385 L387 D389 Y390 C429 Y432 N433 H437 E438 V439
Binding residue
(residue number reindexed from 1)
W42 V48 L53 L55 D57 Y58 C97 Y100 N101 H105 E106 V107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6mnl, PDBe:6mnl, PDBj:6mnl
PDBsum6mnl
PubMed30518851
UniProtO60885|BRD4_HUMAN Bromodomain-containing protein 4 (Gene Name=BRD4)

[Back to BioLiP]