Structure of PDB 6mj8 Chain B Binding Site BS01

Receptor Information
>6mj8 Chain B (length=99) Species: 5478 (Nakaseomyces glabratus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIEIIKDLFEHLCGVRVHRTYEDDTGLWFDTSQGSKNGIMDYKLGFVTEV
IYVPLLKQRTAEELQELQKKLPDYLFETLSFPLRSLNQFYIKMSKSLNK
Ligand information
>6mj8 Chain C (length=20) Species: 5478 (Nakaseomyces glabratus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YIPPTILTKRRNMESFNDCK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mj8 The molecular basis of monopolin recruitment to the kinetochore.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		E79 H80 H87 Y90 D99 G103 I108 D110 L135 R139
Binding residue
(residue number reindexed from 1)		E10 H11 H18 Y21 D30 G34 I39 D41 L55 R59
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0033551 monopolin complex

View graph for
Cellular Component
External links
PDB RCSB:6mj8, PDBe:6mj8, PDBj:6mj8
PDBsum6mj8
PubMed31037469
UniProtQ6FVN3

[Back to BioLiP]