Structure of PDB 6mg1 Chain B Binding Site BS01

Receptor Information
>6mg1 Chain B (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVE
QLSRELSTLRNLFKQLPEPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mg1 Structural basis for effects of CpA modifications on C/EBP beta binding of DNA.
Resolution1.75 Å
Binding residue
(original residue number in PDB)		A284 K287 S288 K291
Binding residue
(residue number reindexed from 1)		A16 K19 S20 K23
Binding affinityPDBbind-CN: Kd=0.029uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6mg1, PDBe:6mg1, PDBj:6mg1
PDBsum6mg1
PubMed30566668
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]