Structure of PDB 6mbd Chain B Binding Site BS01

Receptor Information
>6mbd Chain B (length=154) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDG
VQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLIS
FGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFF
HVED
Ligand information
>6mbd Chain D (length=23) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APKEKEVAETLRKIGEEINEALK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6mbd Tertiary Structural Motif Sequence Statistics Enable Facile Prediction and Design of Peptides that Bind Anti-apoptotic Bfl-1 and Mcl-1.
Resolution1.95 Å
Binding residue
(original residue number in PDB)		H224 M231 K234 R248 V249 V253 D256 N260 G262 R263 T266 F318 F319
Binding residue
(residue number reindexed from 1)		H55 M62 K65 R79 V80 V84 D87 N91 G93 R94 T97 F149 F150
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:6mbd, PDBe:6mbd, PDBj:6mbd
PDBsum6mbd
PubMed30773399
UniProtQ07820|MCL1_HUMAN Induced myeloid leukemia cell differentiation protein Mcl-1 (Gene Name=MCL1)

[Back to BioLiP]