Structure of PDB 6m2m Chain B Binding Site BS01

Receptor Information
>6m2m Chain B (length=86) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYN
KKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTK
Ligand information
>6m2m Chain M (length=10) Species: 39947 (Oryza sativa Japonica Group) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EEDAEDDNDE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m2m OsChz1 acts as a histone chaperone in modulating chromatin organization and genome function in rice.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		R116 Q119 R123 H133 S136 T143
Binding residue
(residue number reindexed from 1)		R58 Q61 R65 H75 S78 T85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6m2m, PDBe:6m2m, PDBj:6m2m
PDBsum6m2m
PubMed33177521
UniProtQ9LQQ4|H2B1_ARATH Histone H2B.1 (Gene Name=At1g07790)

[Back to BioLiP]