Structure of PDB 6lz9 Chain B Binding Site BS01

Receptor Information
>6lz9 Chain B (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDY
EAWLGIHDVHGRGDEKSKQVLQVSQLVYGPEGSDLVLMKLARPAVLDDFV
STIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQ
LQESEICAGAIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRP
GIFVRVAYYAKWIHKIILTYKVP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lz9 Probing conformational and functional states of human hepatocyte growth factor by a panel of monoclonal antibodies.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		N601 C604 T605 I606 Q681 H682 M684 M686
Binding residue
(residue number reindexed from 1)		N107 C110 T111 I112 Q178 H179 M181 M183
Enzymatic activity
Catalytic site (original residue number in PDB) Q534 D578 E670 G671 D672 Y673
Catalytic site (residue number reindexed from 1) Q40 D84 E167 G168 D169 Y170
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lz9, PDBe:6lz9, PDBj:6lz9
PDBsum6lz9
PubMed
UniProtP14210|HGF_HUMAN Hepatocyte growth factor (Gene Name=HGF)

[Back to BioLiP]