Structure of PDB 6lxn Chain B Binding Site BS01

Receptor Information
>6lxn Chain B (length=101) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKL
MNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPD
G
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lxn Structural basis for promoter DNA recognition by the response regulator OmpR.
Resolution2.93 Å
Binding residue
(original residue number in PDB)		T28 G30 R56 R58 V69 W92
Binding residue
(residue number reindexed from 1)		T27 G29 R55 R57 V68 W91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000160 phosphorelay signal transduction system
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lxn, PDBe:6lxn, PDBj:6lxn
PDBsum6lxn
PubMed33152421
UniProtP0AA16|OMPR_ECOLI DNA-binding dual transcriptional regulator OmpR (Gene Name=ompR)

[Back to BioLiP]