Structure of PDB 6ltj Chain B Binding Site BS01

Receptor Information
>6ltj Chain B (length=78) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYT
EHAKRKTVTAMDVVYALKRQGRTLYGFG
Ligand information
>6ltj Chain X (length=119) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaacgc
acgtacgcgctgtcccccgcgttttaaccgccaaggggattactccctag
tctccaggcacgtgtcaga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ltj Structure of nucleosome-bound human BAF complex.
Resolution3.7 Å
Binding residue
(original residue number in PDB)		R35 I46 S47 G48 R78 K79 T80
Binding residue
(residue number reindexed from 1)		R12 I23 S24 G25 R55 K56 T57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ltj, PDBe:6ltj, PDBj:6ltj
PDBsum6ltj
PubMed32001526
UniProtP62799|H4_XENLA Histone H4

[Back to BioLiP]