Structure of PDB 6ls6 Chain B Binding Site BS01

Receptor Information
>6ls6 Chain B (length=138) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK
VVFHLHESFPRPKRVCKDPPYKVEESGYAGFILPIEVYFKNKEEPRKVRF
DYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ls6 Histone benzoylation serves as an epigenetic mark for DPF and YEATS family proteins.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F31 H59 S61 F62 Y81 A82 G83 F84 D106 F108 L109 H110 L111
Binding residue
(residue number reindexed from 1)		F28 H56 S58 F59 Y78 A79 G80 F81 D103 F105 L106 H107 L108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:6ls6, PDBe:6ls6, PDBj:6ls6
PDBsum6ls6
PubMed33290558
UniProtP42568|AF9_HUMAN Protein AF-9 (Gene Name=MLLT3)

[Back to BioLiP]