Structure of PDB 6llb Chain B Binding Site BS01

Receptor Information
>6llb Chain B (length=463) Species: 1094980 (Methanolobus psychrophilus R15) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHSSGLVPRGSHMASTEIGIIAVGGYNEMGRNMTAIRVNEDIIIIDMGI
RLDRVQIHEDVDTDRMHSLELIEMGAIPDDTIMNEVNGNVRAIVCTHGHL
DHIGAIPKLAHRYAAPIIATPYTTALIKHQIDSERKFGVKNNIVALKAGE
TLEITKDITIEFINTQHSIIDTVFVAIHTPSGAVVYACDFKFDRTPTLGE
VPDFDRLKELGKEGVIALITESTNAGRNGKTPSELIAHMMLKDVLLGTEE
SAVGMIVTTFAAHIARVNSIVQFAQEMGRIPVLLGRSMERYVGTAYQLGY
IDLPENVEIYGSRRDIDNALKKIMEAGKDKYLPVMTGHQGEPGAVLGRIA
NGETPFKVETGDRIIFSANVIPNPMTQANRYALETKLKMKGARIYDNVHV
SGHAYREDHWELLRMLKPEHVIPAHGTIQMHSEYIQMAEDAGYSLGDTLH
LLRNGEELYIEED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6llb A newly identified duplex RNA unwinding activity of archaeal RNase J depends on processive exoribonucleolysis coupled steric occlusion by its structural archaeal loops.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		M15 L37 D38 H84 L85 H152 D174 R271 S272 R275 G296 S297 R298 T321 E326 G328 A329 N354 P357 H384 S386 H388 M415
Binding residue
(residue number reindexed from 1)		M30 L52 D53 H99 L100 H167 D189 R286 S287 R290 G311 S312 R313 T336 E341 G343 A344 N369 P372 H399 S401 H403 M430
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Dec 2 03:12:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6llb', asym_id = 'B', bs = 'BS01', title = 'A newly identified duplex RNA unwinding activity...eric occlusion by its structural archaeal loops. '
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6llb', asym_id='B', bs='BS01', title='A newly identified duplex RNA unwinding activity...eric occlusion by its structural archaeal loops. ')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0003723,0004534,0046872', uniprot = '', pdbid = '6llb', asym_id = 'B'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0004534,0046872', uniprot='', pdbid='6llb', asym_id='B')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>