Structure of PDB 6ldw Chain B Binding Site BS01

Receptor Information
>6ldw Chain B (length=197) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSVEESGGRLVTPGTPLTLTCTVSGFSLTSYDMSWVRQAPGKGLEYIGFI
SSTTGGTYYASWAKGRFTISKTSTTVDLKITSPTTEDTATYFCAAGSWYN
MWGPGTLVTVSSGQPKAPSVFPLAPCMTLGCLVKGYLPEPVTVTWNSGTL
TNGVRTFPSVRQSSGLYSLSSVVSVPVTCNVAHPATNTKVDKTVAPS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ldw Structural basis for antigen recognition by methylated lysine-specific antibodies.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		D32 S34 Y46 F49 S51 T53 S97 Y99
Binding residue
(residue number reindexed from 1)		D32 S34 Y46 F49 S51 T53 S97 Y99
External links