Structure of PDB 6l9h Chain B Binding Site BS01

Receptor Information
>6l9h Chain B (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENV
IRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Ligand information
>6l9h Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcttagggttagggttagggttagggttagggttagggttagggttagg
gttagggttagggttagggttagggttagggttagggttagggttagggt
tagggttagggttagggttagggttagggttagggttagggtgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l9h The human telomeric nucleosome displays distinct structural and dynamic properties.
Resolution2.6 Å
Binding residue
(original residue number in PDB)
T30 P32 R36
Binding residue
(residue number reindexed from 1)
T15 P17 R21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6l9h, PDBe:6l9h, PDBj:6l9h
PDBsum6l9h
PubMed
UniProtP62805|H4_HUMAN Histone H4 (Gene Name=H4C1)

[Back to BioLiP]