Structure of PDB 6l6s Chain B Binding Site BS01

Receptor Information
>6l6s Chain B (length=191) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADLAELAAAAGECRGCGLYRDATQAVFGAGGRSARIMMIGEQPGDKEDLA
GLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFKFTRRRIEKTPSRTE
VVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQHRGEVLHVDD
VPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLRVAADV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l6s Structural insights into an MsmUdgX mutant capable of both crosslinking and uracil excision capability.
Resolution2.06426 Å
Binding residue
(original residue number in PDB)		P68 A69 E109 G140 A141 R153 T155 V177 H178 S180 S181 L183 R184
Binding residue
(residue number reindexed from 1)		P57 A58 E93 G124 A125 R137 T139 V161 H162 S164 S165 L167 R168
Enzymatic activity
Enzyme Commision number 2.7.7.7: DNA-directed DNA polymerase.
Gene Ontology
Molecular Function
GO:0004844 uracil DNA N-glycosylase activity
GO:0016779 nucleotidyltransferase activity
GO:0046872 metal ion binding
GO:0051539 4 iron, 4 sulfur cluster binding
GO:0097506 deaminated base DNA N-glycosylase activity
Biological Process
GO:0006281 DNA repair

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6l6s, PDBe:6l6s, PDBj:6l6s
PDBsum6l6s
PubMed33248387
UniProtI7F541

[Back to BioLiP]