Structure of PDB 6l2o Chain B Binding Site BS01

Receptor Information
>6l2o Chain B (length=212) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEASVKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSDENLRDYY
IEWQISFARDGKYDYELSRMVRLAHEHGILTYNDIYELLKFADDVKSYLE
DKGIRRESTNEELYGFNIYEDVYPVAKKELPSGEFIGIVLKHAQRAVGYQ
SMVYVCIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFIIASETH
KNDIVKFLRSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l2o Distortion of double-stranded DNA structure by the binding of the restriction DNA glycosylase R.PabI.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
T25 R26 P27 S45 T46 R47 R184 N185
Binding residue
(residue number reindexed from 1)
T14 R15 P16 S34 T35 R36 R173 N174
Enzymatic activity
Enzyme Commision number ?
External links