Structure of PDB 6kzg Chain B Binding Site BS01

Receptor Information

>6kzg Chain B (length=232) Species: 9606 (Homo sapiens)

QGEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYK
NVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLE
LLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAY
QEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEA
IAELDTLNEDSYKDSTLIMQLLRDNLTLWTSD

Ligand information

>6kzg Chain Q (length=8) Species: 9606 (Homo sapiens)

RSMSETGT

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6kzg 14-3-3 protein in Complex with CIC S301 phosphorylated peptide
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): K49 R56 R127 Y128 G169 L172 N173 L220 D223 N224 L227
• Binding residue (residue number reindexed from 1): K50 R57 R128 Y129 G170 L173 N174 L221 D224 N225 L228

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0019904 protein domain specific binding
• GO:0042802 identical protein binding
• GO:0044325 transmembrane transporter binding
• GO:0071889 14-3-3 protein binding

Biological Process

• GO:0006605 protein targeting
• GO:0007165 signal transduction
• GO:0007264 small GTPase-mediated signal transduction
• GO:0008104 protein localization
• GO:0021762 substantia nigra development
• GO:0034766 negative regulation of monoatomic ion transmembrane transport
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0032991 protein-containing complex
• GO:0045202 synapse
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6kzg, PDBe:6kzg, PDBj:6kzg
• PDBsum: 6kzg
• UniProt: P27348|1433T_HUMAN 14-3-3 protein theta (Gene Name=YWHAQ)