Structure of PDB 6kvm Chain B Binding Site BS01

Receptor Information
>6kvm Chain B (length=179) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPSAFFFCGAISECHYLNGTERVRYLQRYIYNRQQYAHFDSDVGKFVADS
PLGEPQAEYWNSNAELLENRMNEVDRFCRHNYGGVESFTVQRSVEPKVRV
SARLACYVTGFYPPEIEVKWFLNGREETERVVSTDVMQNGDWTYQVLVVL
ETVPRRGDSYVCRVEHASLRQPISQAWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kvm A Newly Recognized Pairing Mechanism of the alpha- and beta-Chains of the Chicken Peptide-MHC Class II Complex.
Resolution1.897 Å
Binding residue
(original residue number in PDB)		S13 Y26 Q28 Y30 P56 Q57 W61 L67 R71 E74 R77 F78 H81 N82
Binding residue
(residue number reindexed from 1)		S12 Y25 Q27 Y29 P55 Q56 W60 L66 R70 E73 R76 F77 H80 N81
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kvm, PDBe:6kvm, PDBj:6kvm
PDBsum6kvm
PubMed32034060
UniProtQ4U600

[Back to BioLiP]