Structure of PDB 6ki6 Chain B Binding Site BS01

Receptor Information
>6ki6 Chain B (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKT
HG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ki6 Structural insights into the recognition of gamma-globin gene promoter by BCL11A.
Resolution2.5 Å
Binding residue
(original residue number in PDB)
N753 S755 S783
Binding residue
(residue number reindexed from 1)
N12 S14 S42
Binding affinityPDBbind-CN: Kd=72nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ki6, PDBe:6ki6, PDBj:6ki6
PDBsum6ki6
PubMed31467406
UniProtQ9H165|BC11A_HUMAN B-cell lymphoma/leukemia 11A (Gene Name=BCL11A)

[Back to BioLiP]