Structure of PDB 6khy Chain B Binding Site BS01

Receptor Information
>6khy Chain B (length=299) Species: 561443 (African swine fever virus tick/South Africa/Pretoriuskop Pr4/1996) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGGMFGAFVSHRLWSDSGCTTTCITNSIANYVAFGEQIGFPFKSAQVFIA
GPRKAVINIQEDDKVELLKMIVKHNLWVVAHGTYLDVPWSRRSAFVTHFI
QQELLICKEVGIKGLVLHLGAVEPELIVEGLKKIKPVEGVVIYLETPHNK
HHTYKYSTMEQIKELFLRIRNTRLKQIGLCIDTAHIWSSGVNISSYNDAG
QWLRSLENIHSVIPPSHIMFHLNDAATECGSGIDRHASLFEGMIWKSYSH
KIKQSGLYCFVEYITRHQCPAILERNLGSSMQLQTALTAEFTTLKSLLK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6khy A unique DNA-binding mode of African swine fever virus AP endonuclease.
Resolution3.008 Å
Binding residue
(original residue number in PDB)		R50 Y81 D231 R232
Binding residue
(residue number reindexed from 1)		R53 Y84 D234 R235
Enzymatic activity
Enzyme Commision number 3.1.21.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0004519 endonuclease activity
GO:0004527 exonuclease activity
GO:0008081 phosphoric diester hydrolase activity
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0006281 DNA repair
GO:0006284 base-excision repair
Cellular Component
GO:0030430 host cell cytoplasm
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6khy, PDBe:6khy, PDBj:6khy
PDBsum6khy
PubMed32194979
UniProtP0C9C6|APE_ASFP4 Probable AP endonuclease (Gene Name=Pret-146)

[Back to BioLiP]