Structure of PDB 6kha Chain B Binding Site BS01

Receptor Information
>6kha Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kha High-resolution structure of a partially folded insulin aggregation intermediate.
ResolutionN/A
Binding residue
(original residue number in PDB)
F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 F24 F25 Y26
Binding residue
(residue number reindexed from 1)
F1 N3 Q4 H5 L6 C7 L11 L15 V18 C19 F24 F25 Y26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:6kha, PDBe:6kha, PDBj:6kha
PDBsum6kha
PubMed32683793
UniProtP01317|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]