Structure of PDB 6kh9 Chain B Binding Site BS01

Receptor Information

>6kh9 Chain B (length=30) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Ligand information

>6kh9 Chain A (length=21) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GIVEQCCASVCSLYQLENYCN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6kh9 High-resolution structure of a partially folded insulin aggregation intermediate.
Resolution	N/A
Binding residue (original residue number in PDB)	F1 N3 C7 G8 L11 L15 C19 R22 Y26
Binding residue (residue number reindexed from 1)	F1 N3 C7 G8 L11 L15 C19 R22 Y26

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005179	hormone activity

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6kh9, PDBe:6kh9, PDBj:6kh9
PDBsum	6kh9
PubMed	32683793
UniProt	P01317\|INS_BOVIN Insulin (Gene Name=INS)

[Back to BioLiP]