Structure of PDB 6kdr Chain B Binding Site BS01

Receptor Information

>6kdr Chain B (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

HMVINGEMQFYARAKLFYQEVPATEEGMMGNFIELSSPDIQASQKFLRKF
VGGPGRAGTDCALDCGSGIGRVSKHVLLPVFNSVELVDMMESFLLEAQNY
LQVKGDKVESYHCYSLQEFTPPFRRYDVIWIQWVSGHLTDKDLLAFLSRC
RDGLKENGIIILKDNVAREGCILDLSDSSVTRDMDILRSLIRKSGLVVLG
QEKQDGFPEQCIPVWMFALH

Ligand information

>6kdr Chain E (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GPKRRQLTF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6kdr Substrate-enzyme engagement regulates state-specific alpha-N methylation of NRMT2
Resolution	2.112 Å
Binding residue (original residue number in PDB)	M87 W191 D232 D235 Q268 C269 I270
Binding residue (residue number reindexed from 1)	M29 W133 D174 D177 Q210 C211 I212

Enzymatic activity

Enzyme Commision number

2.1.1.299: protein N-terminal monomethyltransferase.

Gene Ontology

	Molecular Function
GO:0008168	methyltransferase activity

	Biological Process
GO:0006480	N-terminal protein amino acid methylation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6kdr, PDBe:6kdr, PDBj:6kdr
PDBsum	6kdr
PubMed
UniProt	Q5VVY1\|NTM1B_HUMAN N-terminal Xaa-Pro-Lys N-methyltransferase 2 (Gene Name=NTMT2)

[Back to BioLiP]